Lineage for d1lcsa_ (1lcs A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2371813Fold b.20: ENV polyprotein, receptor-binding domain [49829] (1 superfamily)
    sandwich; 9 strands in 2 sheets; greek-key; contains a few helices in loop regions
  4. 2371814Superfamily b.20.1: ENV polyprotein, receptor-binding domain [49830] (1 family) (S)
    automatically mapped to Pfam PF00429
  5. 2371815Family b.20.1.1: ENV polyprotein, receptor-binding domain [49831] (2 protein domains)
  6. 2371819Protein FLV receptor-binding domain [89254] (1 species)
  7. 2371820Species Feline leukemia virus, strain b/lambda-b1 [TaxId:11768] [89255] (1 PDB entry)
  8. 2371821Domain d1lcsa_: 1lcs A: [84580]
    complexed with toe

Details for d1lcsa_

PDB Entry: 1lcs (more details), 2.5 Å

PDB Description: receptor-binding domain from subgroup b feline leukemia virus
PDB Compounds: (A:) feline leukemia virus receptor-binding domain

SCOPe Domain Sequences for d1lcsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lcsa_ b.20.1.1 (A:) FLV receptor-binding domain {Feline leukemia virus, strain b/lambda-b1 [TaxId: 11768]}
phqvynvtwtitnlvtgtkanatsmlgtltdafptmyfdlcdiigntwnpsdqepfpgyg
cdqpmrrwqqrntpfyvcpghanrkqcggpqdgfcavwgcettgetywrptsswdyitvk
kgvtqgiyqcsgggwcgpcydkavhssttgaseggrcnplilqftqkgrqtswdgpkswg
lrlyrsgydpialfsvsrqvmtitp

SCOPe Domain Coordinates for d1lcsa_:

Click to download the PDB-style file with coordinates for d1lcsa_.
(The format of our PDB-style files is described here.)

Timeline for d1lcsa_: