Lineage for d1l9yb_ (1l9y B:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1937671Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 1937672Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) (S)
  5. 1937673Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 proteins)
  6. 1937674Protein Zn metallo-beta-lactamase [56283] (12 species)
  7. 1937747Species Fluoribacter gormanii, (Legionella gormanii) FEZ-1 [TaxId:464] [82802] (3 PDB entries)
  8. 1937752Domain d1l9yb_: 1l9y B: [84575]
    complexed with cl, gol, so4, zn; mutant

Details for d1l9yb_

PDB Entry: 1l9y (more details), 2.01 Å

PDB Description: fez-1-y228a, a mutant of the metallo-beta-lactamase from legionella gormanii
PDB Compounds: (B:) FEZ-1 b-lactamase

SCOPe Domain Sequences for d1l9yb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l9yb_ d.157.1.1 (B:) Zn metallo-beta-lactamase {Fluoribacter gormanii, (Legionella gormanii) FEZ-1 [TaxId: 464]}
aypmpnpfppfriagnlyyvgtddlasylivtprgnilinsdleanvpmikasikklgfk
fsdtkillishahfdhaagselikqqtkakymvmdedvsvilsggksdfhyandsstyft
qstvdkvlhdgervelggtvltahltpghtrgcttwtmklkdhgkqyqaviigsigvnpg
aklvdnitypkiaedykhsikvlesmrcdiflgshagmfdlknkyvllskgqnnpfvdpt
gcknyieqkandfytelkkqetg

SCOPe Domain Coordinates for d1l9yb_:

Click to download the PDB-style file with coordinates for d1l9yb_.
(The format of our PDB-style files is described here.)

Timeline for d1l9yb_: