Lineage for d1l9ya_ (1l9y A:)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 336044Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 336045Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (3 families) (S)
  5. 336046Family d.157.1.1: Zn metallo-beta-lactamase [56282] (1 protein)
  6. 336047Protein Zn metallo-beta-lactamase [56283] (6 species)
  7. 336081Species Fluoribacter gormanii, (Legionella gormanii) FEZ-1 [TaxId:464] [82802] (3 PDB entries)
  8. 336085Domain d1l9ya_: 1l9y A: [84574]

Details for d1l9ya_

PDB Entry: 1l9y (more details), 2.01 Å

PDB Description: fez-1-y228a, a mutant of the metallo-beta-lactamase from legionella gormanii

SCOP Domain Sequences for d1l9ya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l9ya_ d.157.1.1 (A:) Zn metallo-beta-lactamase {Fluoribacter gormanii, (Legionella gormanii) FEZ-1}
aypmpnpfppfriagnlyyvgtddlasylivtprgnilinsdleanvpmikasikklgfk
fsdtkillishahfdhaagselikqqtkakymvmdedvsvilsggksdfhyandsstyft
qstvdkvlhdgervelggtvltahltpghtrgcttwtmklkdhgkqyqaviigsigvnpg
aklvdnitypkiaedykhsikvlesmrcdiflgshagmfdlknkyvllskgqnnpfvdpt
gcknyieqkandfytelkkqetg

SCOP Domain Coordinates for d1l9ya_:

Click to download the PDB-style file with coordinates for d1l9ya_.
(The format of our PDB-style files is described here.)

Timeline for d1l9ya_: