Lineage for d1l9wa_ (1l9w A:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 383642Fold c.1: TIM beta/alpha-barrel [51350] (28 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 385592Superfamily c.1.10: Aldolase [51569] (5 families) (S)
    Common fold covers whole protein structure
  5. 385593Family c.1.10.1: Class I aldolase [51570] (10 proteins)
    the catalytic lysine forms schiff-base intermediate with substrate
    possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels
  6. 385830Protein Type I 3-dehydroquinate dehydratase [51586] (1 species)
  7. 385831Species Salmonella typhi [TaxId:90370] [51587] (3 PDB entries)
  8. 385833Domain d1l9wa_: 1l9w A: [84570]

Details for d1l9wa_

PDB Entry: 1l9w (more details), 2.1 Å

PDB Description: crystal structure of 3-dehydroquinase from salmonella typhi complexed with reaction product

SCOP Domain Sequences for d1l9wa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l9wa_ c.1.10.1 (A:) Type I 3-dehydroquinate dehydratase {Salmonella typhi}
mktvtvknliigegmpkiivslmgrdinsvkaealayreatfdilewrvdhfmdiastqs
vltaarvirdampdipllftfrsakeggeqtittqhyltlnraaidsglvdmidlelftg
dadvkatvdyahahnvyvvmsnhdfhqtpsaeemvsrlrkmqalgadipkiavmpqskhd
vltlltatlemqqhyadrpvitmsmakegvisrlagevfgsaatfgavkqasapgqiavn
dlrsvlmilhna

SCOP Domain Coordinates for d1l9wa_:

Click to download the PDB-style file with coordinates for d1l9wa_.
(The format of our PDB-style files is described here.)

Timeline for d1l9wa_: