Lineage for d1l9ka_ (1l9k A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1864482Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 1864483Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (58 families) (S)
  5. 1865109Family c.66.1.25: mRNA cap methylase [88785] (3 proteins)
  6. 1865110Protein An RNA cap (nucleoside-2'-O-)-methyltransferase domain of RNA polymerase NS5 [89741] (2 species)
    structurally and functionally similar to VP39
  7. 1865111Species Flavivirus (Dengue virus type 2) [TaxId:12637] [89742] (8 PDB entries)
    Uniprot P12823 2495-2756
  8. 1865114Domain d1l9ka_: 1l9k A: [84569]
    complexed with sah, so4

Details for d1l9ka_

PDB Entry: 1l9k (more details), 2.4 Å

PDB Description: dengue methyltransferase
PDB Compounds: (A:) RNA-directed RNA polymerase

SCOPe Domain Sequences for d1l9ka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l9ka_ c.66.1.25 (A:) An RNA cap (nucleoside-2'-O-)-methyltransferase domain of RNA polymerase NS5 {Flavivirus (Dengue virus type 2) [TaxId: 12637]}
etlgekwksrlnalgksefqiykksgiqevdrtlakegikrgetdhhavsrgsaklrwfv
ernlvtpegkvvdlgcgrggwsyycgglknvrevkgltkggpgheepipmstygwnlvrl
qsgvdvffippercdtllcdigesspnptveagrtlrvlnlvenwlsnntqfcvkvlnpy
mssviekmealqrkhggalvrnplsrnsthemywvsnasgnivssvnmisrmlinrftmr
hkkatyepdvdlgsgtrnigi

SCOPe Domain Coordinates for d1l9ka_:

Click to download the PDB-style file with coordinates for d1l9ka_.
(The format of our PDB-style files is described here.)

Timeline for d1l9ka_: