Lineage for d1l9ga_ (1l9g A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1837328Fold c.18: Uracil-DNA glycosylase-like [52140] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134
  4. 1837329Superfamily c.18.1: Uracil-DNA glycosylase-like [52141] (5 families) (S)
  5. 1837400Family c.18.1.2: Mug-like [52147] (3 proteins)
  6. 1837412Protein Thermophilic uracil-DNA glycosylase [89577] (2 species)
  7. 1837413Species Thermotoga maritima [TaxId:2336] [89578] (2 PDB entries)
    gene TM0511
  8. 1837415Domain d1l9ga_: 1l9g A: [84568]
    complexed with sf4, so4

Details for d1l9ga_

PDB Entry: 1l9g (more details), 2.5 Å

PDB Description: crystal structure of uracil-dna glycosylase from t. maritima
PDB Compounds: (A:) conserved hypothetical protein

SCOPe Domain Sequences for d1l9ga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l9ga_ c.18.1.2 (A:) Thermophilic uracil-DNA glycosylase {Thermotoga maritima [TaxId: 2336]}
mytreelmeivservkkctacplhlnrtnvvvgegnldtrivfvgegpgeeedktgrpfv
gragmlltellresgirredvyicnvvkcrppnnrtptpeeqaacghfllaqieiinpdv
ivalgatalsffvdgkkvsitkvrgnpidwlggkkviptfhpsyllrnrsnelrrivled
iekaksfikke

SCOPe Domain Coordinates for d1l9ga_:

Click to download the PDB-style file with coordinates for d1l9ga_.
(The format of our PDB-style files is described here.)

Timeline for d1l9ga_: