SCOP 1.65: Domain d1l9ga_: 1l9g A:

Lineage for d1l9ga_ (1l9g A:)

1. Root: SCOP 1.65

2. Class c: Alpha and beta proteins (a/b) [51349] (121 folds)

3. Fold c.18: DNA glycosylase [52140] (1 superfamily)
   3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.18.1: DNA glycosylase [52141] (3 families)

5. Family c.18.1.2: Mug-like [52147] (2 proteins)

6. Protein Thermophilic uracil-DNA glycosylase [89577] (1 species)

7. Species Thermotoga maritima [TaxId:243274] [89578] (1 PDB entry)
   gene TM0511

8. Domain d1l9ga_: 1l9g A: [84568]
   complexed with fs4, so4

Details for d1l9ga_

PDB Entry: 1l9g, 2.5 Å

PDB Description: crystal structure of uracil-dna glycosylase from t. maritima

SCOP Domain Sequences for d1l9ga_:

Sequence; same for both SEQRES and ATOM records:

>d1l9ga_ c.18.1.2 (A:) Thermophilic uracil-DNA glycosylase {Thermotoga maritima}
mytreelmeivservkkctacplhlnrtnvvvgegnldtrivfvgegpgeeedktgrpfv
gragmlltellresgirredvyicnvvkcrppnnrtptpeeqaacghfllaqieiinpdv
ivalgatalsffvdgkkvsitkvrgnpidwlggkkviptfhpsyllrnrsnelrrivled
iekaksfikke

Timeline for d1l9ga_:

• d1l9ga_ is new in SCOP 1.65
  
• d1l9ga_ appears in SCOP 1.67
  
• d1l9ga_ appears in the current release, SCOPe 2.08