Lineage for d1l8na1 (1l8n A:143-678)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 305036Fold c.1: TIM beta/alpha-barrel [51350] (26 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 305661Superfamily c.1.8: (Trans)glycosidases [51445] (9 families) (S)
  5. 306509Family c.1.8.10: alpha-D-glucuronidase catalytic domain [82253] (1 protein)
    Glycosyl hydrolase family 67, GH67; structurally related to GH20; contains extra C-terminal alpha-helical subdomain
  6. 306510Protein alpha-D-glucuronidase catalytic domain [82254] (2 species)
    inverting reaction mechanism
  7. 306511Species Bacillus stearothermophilus [TaxId:1422] [82256] (4 PDB entries)
  8. 306512Domain d1l8na1: 1l8n A:143-678 [84564]
    Other proteins in same PDB: d1l8na2
    complexed with gcw, gol, xyp

Details for d1l8na1

PDB Entry: 1l8n (more details), 1.5 Å

PDB Description: the 1.5a crystal structure of alpha-d-glucuronidase from bacillus stearothermophilus t-1, complexed with 4-o-methyl-glucuronic acid and xylotriose

SCOP Domain Sequences for d1l8na1:

Sequence, based on SEQRES records: (download)

>d1l8na1 c.1.8.10 (A:143-678) alpha-D-glucuronidase catalytic domain {Bacillus stearothermophilus}
rlrminhwdnmdgsiergyagrsiffvddqfvkqnqrikdyarllasvginaisinnvnv
hktetklitdhflpdvaevadifrtygiktflsinyaspieigglptadpldpevrwwwk
etakriyqyipdfggfvvkadsefrpgpftygrdhaeganmlaealapfgglviwrcfvy
ncqqdwrdrttdrakaaydhfkpldgqfrenvilqikngpmdfqvrepvsplfgampktn
qmmevqitqeytgqqkhlcflipqwkevldfdtyakgkgsevkkvidgslfdyrysgiag
vsnigsdpnwtghtlaqanlygfgrlawnpdlsaeeianewvvqtfgddsqvvetiswml
lsswriyenytsplgvgwmvnpghhygpnvdgyeyshwgtyhyadrdgigvdrtvatgtg
ytaqyfpenaamyesldtcpdelllffhhvpythrlhsgetviqhiynthfegveqakql
rkrweqlkgkidekryhdvlerltiqvehakewrdvintyfyrksgiddqygrkiy

Sequence, based on observed residues (ATOM records): (download)

>d1l8na1 c.1.8.10 (A:143-678) alpha-D-glucuronidase catalytic domain {Bacillus stearothermophilus}
rlrminhwdnmdgsiergyagrsiffvddqfvnqrikdyarllasvginaisinnvnvhk
tetklitdhflpdvaevadifrtygiktflsinyaspieigglptadpldpevrwwwket
akriyqyipdfggfvvkadsefrpgpftygrdhaeganmlaealapfgglviwrcfvync
qqdwrdrttdrakaaydhfkpldgqfrenvilqikngpmdfqvrepvsplfgampktnqm
mevqitqeytgqqkhlcflipqwkevldfdtyakgkgsevkkvidgslfdyrysgiagvs
nigsdpnwtghtlaqanlygfgrlawnpdlsaeeianewvvqtfgddsqvvetiswmlls
swriyenytsplgvgwmvnpghhygpnvdgyeyshwgtyhyadrdgigvdrtvatgtgyt
aqyfpenaamyesldtcpdelllffhhvpythrlhsgetviqhiynthfegveqakqlrk
rweqlkgkidekryhdvlerltiqvehakewrdvintyfyrksgiddqygrkiy

SCOP Domain Coordinates for d1l8na1:

Click to download the PDB-style file with coordinates for d1l8na1.
(The format of our PDB-style files is described here.)

Timeline for d1l8na1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1l8na2