|  | Class a: All alpha proteins [46456] (179 folds) | 
|  | Fold a.25: Ferritin-like [47239] (2 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection | 
|  | Superfamily a.25.1: Ferritin-like [47240] (2 families)  contains dimetal-ion centre in the middle of the bundle | 
|  | Family a.25.1.1: Ferritin [47241] (5 proteins) | 
|  | Protein Dodecameric ferritin homolog [47250] (7 species) | 
|  | Species Escherichia coli, Dps [TaxId:562] [47251] (7 PDB entries) ferritin homolog that binds to and protects DNA | 
|  | Domain d1l8ik_: 1l8i K: [84560] | 
PDB Entry: 1l8i (more details), 3 Å
SCOP Domain Sequences for d1l8ik_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1l8ik_ a.25.1.1 (K:) Dodecameric ferritin homolog {Escherichia coli, Dps}
tnllytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfiavhemldgfrt
alichlatmaeravqlggvalgttqvinsktplksypldihnvqdhlkeladryaivand
vrkaigeakdddtadiltaasrdldkflwfiesnie
Timeline for d1l8ik_: