| Class a: All alpha proteins [46456] (218 folds) |
| Fold a.25: Ferritin-like [47239] (2 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (3 families) ![]() contains bimetal-ion centre in the middle of the bundle |
| Family a.25.1.1: Ferritin [47241] (7 proteins) |
| Protein Dodecameric ferritin homolog [47250] (10 species) |
| Species Escherichia coli, Dps [TaxId:562] [47251] (7 PDB entries) ferritin homolog that binds to and protects DNA |
| Domain d1l8hg_: 1l8h G: [84544] |
PDB Entry: 1l8h (more details), 3.2 Å
SCOP Domain Sequences for d1l8hg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1l8hg_ a.25.1.1 (G:) Dodecameric ferritin homolog {Escherichia coli, Dps}
tnllytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfiavhemldgfrt
alichlatmaeravqlggvalgttqvinsktplksypldihnvqdhlkeladryaivand
vrkaigeakdddtadiltaasrdldkflwfiesnie
Timeline for d1l8hg_: