SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1l8hf_ (1l8h F:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1988413Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1988414Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1988415Family a.25.1.1: Ferritin [47241] (10 protein domains)
  6. 1988893Protein Dodecameric ferritin homolog [47250] (14 species)
  7. 1988916Species Escherichia coli, Dps [TaxId:562] [47251] (7 PDB entries)
    ferritin homolog that binds to and protects DNA
  8. 1989006Domain d1l8hf_: 1l8h F: [84543]
    protein/DNA complex; complexed with k, trs

Details for d1l8hf_

PDB Entry: 1l8h (more details), 3.2 Å

PDB Description: dna protection and binding by e. coli dps protein
PDB Compounds: (F:) DNA protection during starvation protein

SCOPe Domain Sequences for d1l8hf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l8hf_ a.25.1.1 (F:) Dodecameric ferritin homolog {Escherichia coli, Dps [TaxId: 562]}
llytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfiavhemldgfrtal
ichlatmaeravqlggvalgttqvinsktplksypldihnvqdhlkeladryaivandvr
kaigeakdddtadiltaasrdldkflwfiesnie

SCOPe Domain Coordinates for d1l8hf_:

Click to download the PDB-style file with coordinates for d1l8hf_.
(The format of our PDB-style files is described here.)

Timeline for d1l8hf_: