Lineage for d1l8hb_ (1l8h B:)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 353826Fold a.25: Ferritin-like [47239] (2 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 353827Superfamily a.25.1: Ferritin-like [47240] (3 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 353828Family a.25.1.1: Ferritin [47241] (7 proteins)
  6. 353960Protein Dodecameric ferritin homolog [47250] (9 species)
  7. 353988Species Escherichia coli, Dps [TaxId:562] [47251] (7 PDB entries)
    ferritin homolog that binds to and protects DNA
  8. 354074Domain d1l8hb_: 1l8h B: [84539]

Details for d1l8hb_

PDB Entry: 1l8h (more details), 3.2 Å

PDB Description: dna protection and binding by e. coli dps protein

SCOP Domain Sequences for d1l8hb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l8hb_ a.25.1.1 (B:) Dodecameric ferritin homolog {Escherichia coli, Dps}
llytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfiavhemldgfrtal
ichlatmaeravqlggvalgttqvinsktplksypldihnvqdhlkeladryaivandvr
kaigeakdddtadiltaasrdldkflwfiesnie

SCOP Domain Coordinates for d1l8hb_:

Click to download the PDB-style file with coordinates for d1l8hb_.
(The format of our PDB-style files is described here.)

Timeline for d1l8hb_: