| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) ![]() contains bimetal-ion centre in the middle of the bundle |
| Family a.25.1.1: Ferritin [47241] (10 protein domains) |
| Protein Dodecameric ferritin homolog [47250] (14 species) |
| Species Escherichia coli, Dps [TaxId:562] [47251] (7 PDB entries) ferritin homolog that binds to and protects DNA |
| Domain d1l8hb_: 1l8h B: [84539] protein/DNA complex; complexed with k, trs |
| PDB Entry: 1l8h (more details) PDB Description: dna protection and binding by e. coli dps protein
PDB Compounds: (B:) DNA protection during starvation proteinSCOP Domain Sequences for d1l8hb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1l8hb_ a.25.1.1 (B:) Dodecameric ferritin homolog {Escherichia coli, Dps [TaxId: 562]}
llytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfiavhemldgfrtal
ichlatmaeravqlggvalgttqvinsktplksypldihnvqdhlkeladryaivandvr
kaigeakdddtadiltaasrdldkflwfiesnie
SCOP Domain Coordinates for d1l8hb_:
Click to download the PDB-style file with coordinates for d1l8hb_. (The format of our PDB-style files is described here.)
Timeline for d1l8hb_:
d1l8hb_ appears in SCOP 1.75A | d1l8hb_ (click for larger image) d1l8hb_ in context of chain d1l8hb_ in context of PDB Domains from other chains: d1l8ha_, d1l8hc_, d1l8hd_, d1l8he_, d1l8hf_, d1l8hg_, d1l8hh_, d1l8hi_, d1l8hj_, d1l8hk_, d1l8hl_ |
|
|
Copyright © 1994-2013 The SCOP
and Astral authors scop@mrc-lmb.cam.ac.uk and astral@compbio.berkeley.edu |