SCOP 1.73: Domain d1l6mb_: 1l6m B:

Lineage for d1l6mb_ (1l6m B:)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (8 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.1: Retinol binding protein-like [50815] (20 proteins)
   barrel, closed; n=8, S=12, meander

6. Protein Neutrophil gelatinase-associated lipocalin (NGAL) [50835] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50836] (7 PDB entries)

8. Domain d1l6mb_: 1l6m B: [84532]

Details for d1l6mb_

PDB Entry: 1l6m, 2.4 Å

PDB Description: neutrophil gelatinase-associated lipocalin is a novel bacteriostatic agent that interferes with siderophore-mediated iron acquisition

PDB Compounds: (B:) Neutrophil gelatinase-associated lipocalin

SCOP Domain Sequences for d1l6mb_:

Sequence, based on SEQRES records:

>d1l6mb_ b.60.1.1 (B:) Neutrophil gelatinase-associated lipocalin (NGAL) {Human (Homo sapiens) [TaxId: 9606]}
tsdlipapplskvplqqnfqdnqfqgkwyvvglagnailredkdpqkmyatiyelkedks
ynvtsvlfrkkkcdywirtfvpgsqpgeftlgniksypgltsylvrvvstnynqhamvff
kkvsqnreyfkitlygrtkeltselkenfirfskslglpenhivfpvpidqcid

Sequence, based on observed residues (ATOM records):

>d1l6mb_ b.60.1.1 (B:) Neutrophil gelatinase-associated lipocalin (NGAL) {Human (Homo sapiens) [TaxId: 9606]}
tsdlipapplskvplqqnfqdnqfqgkwyvvglagnailrpqkmyatiyelkedksynvt
svlfrkkkcdywirtfvpgsqpgeftlgniksypgltsylvrvvstnynqhamvffkkvs
qnreyfkitlygrtkeltelkenfirfskslglpenhivfpvpidqcid

Timeline for d1l6mb_:

• d1l6mb_ first appeared in SCOP 1.65
  
• d1l6mb_ appears in SCOP 1.71
  
• d1l6mb_ appears in SCOP 1.75
  
• d1l6mb_ appears in the current release, SCOPe 2.08