SCOP 1.75: Domain d1l6ma_: 1l6m A:

Lineage for d1l6ma_ (1l6m A:)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (9 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.1: Retinol binding protein-like [50815] (21 proteins)
   barrel, closed; n=8, S=12, meander

6. Protein Neutrophil gelatinase-associated lipocalin (NGAL) [50835] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50836] (7 PDB entries)

8. Domain d1l6ma_: 1l6m A: [84531]

Details for d1l6ma_

PDB Entry: 1l6m, 2.4 Å

PDB Description: neutrophil gelatinase-associated lipocalin is a novel bacteriostatic agent that interferes with siderophore-mediated iron acquisition

PDB Compounds: (A:) Neutrophil gelatinase-associated lipocalin

SCOP Domain Sequences for d1l6ma_:

Sequence; same for both SEQRES and ATOM records:

>d1l6ma_ b.60.1.1 (A:) Neutrophil gelatinase-associated lipocalin (NGAL) {Human (Homo sapiens) [TaxId: 9606]}
tsdlipapplskvplqqnfqdnqfqgkwyvvglagnailredkdpqkmyatiyelkedks
ynvtsvlfrkkkcdywirtfvpgsqpgeftlgniksypgltsylvrvvstnynqhamvff
kkvsqnreyfkitlygrtkeltselkenfirfskslglpenhivfpvpidqcid

Timeline for d1l6ma_:

• d1l6ma_ first appeared in SCOP 1.65
  
• d1l6ma_ appears in SCOP 1.73
  
• d1l6ma_ appears in SCOPe 2.01
  
• d1l6ma_ appears in the current release, SCOPe 2.08