Lineage for d1l6ma_ (1l6m A:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 673645Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 673646Superfamily b.60.1: Lipocalins [50814] (8 families) (S)
    bind hydrophobic ligands in their interior
  5. 673647Family b.60.1.1: Retinol binding protein-like [50815] (20 proteins)
    barrel, closed; n=8, S=12, meander
  6. 673763Protein Neutrophil gelatinase-associated lipocalin (NGAL) [50835] (1 species)
  7. 673764Species Human (Homo sapiens) [TaxId:9606] [50836] (7 PDB entries)
  8. 673774Domain d1l6ma_: 1l6m A: [84531]

Details for d1l6ma_

PDB Entry: 1l6m (more details), 2.4 Å

PDB Description: neutrophil gelatinase-associated lipocalin is a novel bacteriostatic agent that interferes with siderophore-mediated iron acquisition
PDB Compounds: (A:) Neutrophil gelatinase-associated lipocalin

SCOP Domain Sequences for d1l6ma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l6ma_ b.60.1.1 (A:) Neutrophil gelatinase-associated lipocalin (NGAL) {Human (Homo sapiens) [TaxId: 9606]}
tsdlipapplskvplqqnfqdnqfqgkwyvvglagnailredkdpqkmyatiyelkedks
ynvtsvlfrkkkcdywirtfvpgsqpgeftlgniksypgltsylvrvvstnynqhamvff
kkvsqnreyfkitlygrtkeltselkenfirfskslglpenhivfpvpidqcid

SCOP Domain Coordinates for d1l6ma_:

Click to download the PDB-style file with coordinates for d1l6ma_.
(The format of our PDB-style files is described here.)

Timeline for d1l6ma_: