Lineage for d1l3va1 (1l3v A:297-468)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 701284Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 701966Superfamily c.55.3: Ribonuclease H-like [53098] (12 families) (S)
    consists of one domain of this fold
  5. 702237Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (14 proteins)
    contains Pfam PF00929
  6. 702290Protein Exonuclease domain of prokaryotic DNA polymerase [53119] (3 species)
    part of Klenow fragment, KF
  7. 702291Species Bacillus stearothermophilus, newly identified strain as yet unnamed [TaxId:1422] [53122] (42 PDB entries)
  8. 702299Domain d1l3va1: 1l3v A:297-468 [84527]
    Other proteins in same PDB: d1l3va2
    complexed with mg, so4, suc

Details for d1l3va1

PDB Entry: 1l3v (more details), 1.71 Å

PDB Description: crystal structure of bacillus dna polymerase i fragment product complex with 15 base pairs of duplex dna following addition of dttp, datp, dctp, and dgtp residues.
PDB Compounds: (A:) DNA polymerase I

SCOP Domain Sequences for d1l3va1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l3va1 c.55.3.5 (A:297-468) Exonuclease domain of prokaryotic DNA polymerase {Bacillus stearothermophilus, newly identified strain as yet unnamed [TaxId: 1422]}
akmaftladrvteemladkaalvvevveenyhdapivgiavvnehgrfflrpetaladpq
fvawlgdetkkksmfdskraavalkwkgielcgvsfdlllaaylldpaqgvddvaaaakm
kqyeavrpdeavygkgakravpdepvlaehlvrkaaaiwelerpfldelrrn

SCOP Domain Coordinates for d1l3va1:

Click to download the PDB-style file with coordinates for d1l3va1.
(The format of our PDB-style files is described here.)

Timeline for d1l3va1: