Lineage for d1l3ua1 (1l3u A:297-468)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 316624Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 316908Superfamily c.55.3: Ribonuclease H-like [53098] (7 families) (S)
    consists of one domain of this fold
  5. 317107Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (6 proteins)
  6. 317130Protein Exonuclease domain of prokaryotic DNA polymerase [53119] (3 species)
    part of Klenow fragment, KF
  7. 317131Species Bacillus stearothermophilus, newly identified strain as yet unnamed [TaxId:1422] [53122] (10 PDB entries)
  8. 317136Domain d1l3ua1: 1l3u A:297-468 [84525]
    Other proteins in same PDB: d1l3ua2
    complexed with mg, so4, suc

Details for d1l3ua1

PDB Entry: 1l3u (more details), 1.8 Å

PDB Description: crystal structure of bacillus dna polymerase i fragment product complex with 11 base pairs of duplex dna following addition of a dttp and a datp residue.

SCOP Domain Sequences for d1l3ua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l3ua1 c.55.3.5 (A:297-468) Exonuclease domain of prokaryotic DNA polymerase {Bacillus stearothermophilus, newly identified strain as yet unnamed}
akmaftladrvteemladkaalvvevveenyhdapivgiavvnehgrfflrpetaladpq
fvawlgdetkkksmfdskraavalkwkgielcgvsfdlllaaylldpaqgvddvaaaakm
kqyeavrpdeavygkgakravpdepvlaehlvrkaaaiwelerpfldelrrn

SCOP Domain Coordinates for d1l3ua1:

Click to download the PDB-style file with coordinates for d1l3ua1.
(The format of our PDB-style files is described here.)

Timeline for d1l3ua1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1l3ua2