![]() | Class c: Alpha and beta proteins (a/b) [51349] (121 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
![]() | Superfamily c.55.3: Ribonuclease H-like [53098] (7 families) ![]() consists of one domain of this fold |
![]() | Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (6 proteins) |
![]() | Protein Exonuclease domain of prokaryotic DNA polymerase [53119] (3 species) part of Klenow fragment, KF |
![]() | Species Bacillus stearothermophilus, newly identified strain as yet unnamed [TaxId:1422] [53122] (10 PDB entries) |
![]() | Domain d1l3ua1: 1l3u A:297-468 [84525] Other proteins in same PDB: d1l3ua2 complexed with mg, so4, suc |
PDB Entry: 1l3u (more details), 1.8 Å
SCOP Domain Sequences for d1l3ua1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1l3ua1 c.55.3.5 (A:297-468) Exonuclease domain of prokaryotic DNA polymerase {Bacillus stearothermophilus, newly identified strain as yet unnamed} akmaftladrvteemladkaalvvevveenyhdapivgiavvnehgrfflrpetaladpq fvawlgdetkkksmfdskraavalkwkgielcgvsfdlllaaylldpaqgvddvaaaakm kqyeavrpdeavygkgakravpdepvlaehlvrkaaaiwelerpfldelrrn
Timeline for d1l3ua1: