Lineage for d1l3sa2 (1l3s A:469-876)

  1. Root: SCOPe 2.01
  2. 1054197Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)
  3. 1055706Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 1055707Superfamily e.8.1: DNA/RNA polymerases [56672] (6 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 1055708Family e.8.1.1: DNA polymerase I [56673] (4 proteins)
  6. 1055709Protein DNA polymerase I (Klenow fragment) [56674] (3 species)
  7. 1055710Species Bacillus stearothermophilus, newly identified strain as yet unnamed [TaxId:1422] [56677] (42 PDB entries)
    Uniprot Q5KWC1 299-878 # 99% sequence identity; Geobacillus kaustophilus TaxID:1462
    Uniprot Q45458 298-876 # 88% sequence identity
  8. 1055716Domain d1l3sa2: 1l3s A:469-876 [84522]
    Other proteins in same PDB: d1l3sa1
    protein/DNA complex; complexed with mg, so4, suc

Details for d1l3sa2

PDB Entry: 1l3s (more details), 1.7 Å

PDB Description: crystal structure of bacillus dna polymerase i fragment complexed to 9 base pairs of duplex dna.
PDB Compounds: (A:) DNA polymerase I

SCOPe Domain Sequences for d1l3sa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l3sa2 e.8.1.1 (A:469-876) DNA polymerase I (Klenow fragment) {Bacillus stearothermophilus, newly identified strain as yet unnamed [TaxId: 1422]}
eqdrllveleqplssilaemefagvkvdtkrleqmgkelaeqlgtveqriyelagqefni
nspkqlgvilfeklqlpvlkktktgystsadvleklapyheivenilhyrqlgklqstyi
egllkvvrpdtkkvhtifnqaltqtgrlsstepnlqnipirleegrkirqafvpsesdwl
ifaadysqielrvlahiaeddnlmeafrrdldihtktamdifqvsedevtpnmrrqakav
nfgivygisdyglaqnlnisrkeaaefieryfesfpgvkrymenivqeakqkgyvttllh
rrrylpditsrnfnvrsfaermamntpiqgsaadiikkamidlnarlkeerlqahlllqv
hdelileapkeemerlcrlvpevmeqavtlrvplkvdyhygstwydak

SCOPe Domain Coordinates for d1l3sa2:

Click to download the PDB-style file with coordinates for d1l3sa2.
(The format of our PDB-style files is described here.)

Timeline for d1l3sa2: