SCOP 1.71: Domain d1l3sa1: 1l3s A:297-468

Lineage for d1l3sa1 (1l3s A:297-468)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (10 families)
   consists of one domain of this fold

5. Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (10 proteins)
   contains Pfam 00929

6. Protein Exonuclease domain of prokaryotic DNA polymerase [53119] (3 species)
   part of Klenow fragment, KF

7. Species Bacillus stearothermophilus, newly identified strain as yet unnamed [TaxId:1422] [53122] (32 PDB entries)

8. Domain d1l3sa1: 1l3s A:297-468 [84521]
   Other proteins in same PDB: d1l3sa2
   complexed with mg, so4, suc

Details for d1l3sa1

PDB Entry: 1l3s, 1.7 Å

PDB Description: crystal structure of bacillus dna polymerase i fragment complexed to 9 base pairs of duplex dna.

SCOP Domain Sequences for d1l3sa1:

Sequence; same for both SEQRES and ATOM records:

>d1l3sa1 c.55.3.5 (A:297-468) Exonuclease domain of prokaryotic DNA polymerase {Bacillus stearothermophilus, newly identified strain as yet unnamed}
akmaftladrvteemladkaalvvevveenyhdapivgiavvnehgrfflrpetaladpq
fvawlgdetkkksmfdskraavalkwkgielcgvsfdlllaaylldpaqgvddvaaaakm
kqyeavrpdeavygkgakravpdepvlaehlvrkaaaiwelerpfldelrrn

Timeline for d1l3sa1:

• d1l3sa1 first appeared in SCOP 1.65
  
• d1l3sa1 appears in SCOP 1.69
  
• d1l3sa1 appears in SCOP 1.73
  
• d1l3sa1 appears in the current release, SCOPe 2.08