Lineage for d1l3ha_ (1l3h A:)

  1. Root: SCOP 1.73
  2. 746751Class g: Small proteins [56992] (85 folds)
  3. 749797Fold g.28: Thyroglobulin type-1 domain [57609] (1 superfamily)
    disulfide-rich, alpha+beta
  4. 749798Superfamily g.28.1: Thyroglobulin type-1 domain [57610] (1 family) (S)
  5. 749799Family g.28.1.1: Thyroglobulin type-1 domain [57611] (2 proteins)
    Pfam PF00086
  6. 749800Protein Class II MHC associated p41 invariant chain fragment [57612] (1 species)
  7. 749801Species Human (Homo sapiens) [TaxId:9606] [57613] (2 PDB entries)
  8. 749804Domain d1l3ha_: 1l3h A: [84519]

Details for d1l3ha_

PDB Entry: 1l3h (more details)

PDB Description: nmr structure of p41icf, a potent inhibitor of human cathepsin l
PDB Compounds: (A:) MHC CLASS II-ASSOCIATED P41 INVARIANT CHAIN FRAGMENT (P41icf)

SCOP Domain Sequences for d1l3ha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l3ha_ g.28.1.1 (A:) Class II MHC associated p41 invariant chain fragment {Human (Homo sapiens) [TaxId: 9606]}
ltkcqeevshipavhpgsfrpkcdengnylplqcygsigycwcvfpngtevpntrsrghh
ncses

SCOP Domain Coordinates for d1l3ha_:

Click to download the PDB-style file with coordinates for d1l3ha_.
(The format of our PDB-style files is described here.)

Timeline for d1l3ha_: