Lineage for d1l1pa_ (1l1p A:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 601019Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 601020Superfamily d.26.1: FKBP-like [54534] (3 families) (S)
  5. 601021Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (16 proteins)
  6. 601157Protein Trigger factor PPIase domain [75388] (3 species)
  7. 601158Species Escherichia coli [TaxId:562] [89881] (2 PDB entries)
  8. 601161Domain d1l1pa_: 1l1p A: [84518]

Details for d1l1pa_

PDB Entry: 1l1p (more details)

PDB Description: solution structure of the ppiase domain from e. coli trigger factor

SCOP Domain Sequences for d1l1pa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l1pa_ d.26.1.1 (A:) Trigger factor PPIase domain {Escherichia coli}
gshmqatwkekdgaveaedrvtidftgsvdgeefeggkasdfvlamgqgrmipgfedgik
ghkageeftidvtfpeeyhaenlkgkaakfainlkkveerelpelt

SCOP Domain Coordinates for d1l1pa_:

Click to download the PDB-style file with coordinates for d1l1pa_.
(The format of our PDB-style files is described here.)

Timeline for d1l1pa_: