Lineage for d1l1pa_ (1l1p A:)
- Root: SCOP 1.69
Class d: Alpha and beta proteins (a+b) [53931] (279 folds) 
Fold d.26: FKBP-like [54533] (3 superfamilies)
core: beta(2)-alpha-beta(2); antiparallel beta-sheet
Superfamily d.26.1: FKBP-like [54534] (3 families) 
Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (16 proteins) 
Protein Trigger factor PPIase domain [75388] (3 species) 
Species Escherichia coli [TaxId:562] [89881] (2 PDB entries) 
Domain d1l1pa_: 1l1p A: [84518]
Details for d1l1pa_
PDB Entry: 1l1p (more details)
PDB Description: solution structure of the ppiase domain from e. coli trigger factor
SCOP Domain Sequences for d1l1pa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1l1pa_ d.26.1.1 (A:) Trigger factor PPIase domain {Escherichia coli}
gshmqatwkekdgaveaedrvtidftgsvdgeefeggkasdfvlamgqgrmipgfedgik
ghkageeftidvtfpeeyhaenlkgkaakfainlkkveerelpelt
SCOP Domain Coordinates for d1l1pa_:
Click to download the PDB-style file with coordinates for d1l1pa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1l1pa_:
- d1l1pa_ first appeared in SCOP 1.65
- d1l1pa_ appears in SCOP 1.67
- d1l1pa_ appears in SCOP 1.71
- d1l1pa_ appears in the current release, SCOPe 2.08, called d1l1pa1
View in 3D