SCOPe 2.05: Domain d1l1jb_: 1l1j B:

Lineage for d1l1jb_ (1l1j B:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.1: Prokaryotic proteases [50495] (16 proteins)

6. Protein Protease Do (DegP, HtrA), catalytic domain [74969] (2 species)

7. Species Thermotoga maritima [TaxId:2336] [89339] (1 PDB entry)

8. Domain d1l1jb_: 1l1j B: [84517]
   catalytic domain only

Details for d1l1jb_

PDB Entry: 1l1j, 2.8 Å

PDB Description: Crystal structure of the protease domain of an ATP-independent heat shock protease HtrA

PDB Compounds: (B:) heat shock protease HtrA

SCOPe Domain Sequences for d1l1jb_:

Sequence, based on SEQRES records:

>d1l1jb_ b.47.1.1 (B:) Protease Do (DegP, HtrA), catalytic domain {Thermotoga maritima [TaxId: 2336]}
dyespivnvveacapavvkidvvktvktsffdpyfeqffkkwfgelppgferqvaslgsg
fifdpegyiltnyhvvggadnitvtmldgskydaeyiggdeeldiavikikasdkkfpyl
efgdsdkvkigewaiaignplgfqhtvtvgvvsatnrripkpdgsgyyvgliqtdaainp
gnsggpllnihgevigintaivnpqeavnlgfaipintvkkfldtilt

Sequence, based on observed residues (ATOM records):

>d1l1jb_ b.47.1.1 (B:) Protease Do (DegP, HtrA), catalytic domain {Thermotoga maritima [TaxId: 2336]}
dyespivnvveacapavvkidvvkttsffdpyfeqffkkwfgelppgferqvaslgsgfi
fdpegyiltnyhvvggadnitvtmldgskydaeyiggdeeldiavikikasdkkfpylef
gdsdkvkigewaiaignplgfqhtvtvgvvsatnrripkpdgsgyyvgliqtdaainpgn
sggpllnihgevigintaivnpqeavnlgfaipintvkkfldtilt

Timeline for d1l1jb_:

• d1l1jb_ first appeared in SCOP 1.65
  
• d1l1jb_ appears in SCOPe 2.04
  
• d1l1jb_ appears in SCOPe 2.06
  
• d1l1jb_ appears in the current release, SCOPe 2.08