![]() | Class f: Membrane and cell surface proteins and peptides [56835] (47 folds) |
![]() | Fold f.28: Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81532] (1 superfamily) membrane-associated alpha-helical protein; no transmembrane helices |
![]() | Superfamily f.28.1: Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81531] (1 family) ![]() location - intermembrane side of the bc1 complex |
![]() | Family f.28.1.1: Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81530] (1 protein) "acidic/hinge protein", essential for the complex formation, interacts with the functional domain of cytochrome c1 |
![]() | Protein Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81529] (3 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [81526] (12 PDB entries) |
![]() | Domain d1l0nh_: 1l0n H: [84510] Other proteins in same PDB: d1l0na1, d1l0na2, d1l0nb1, d1l0nb2, d1l0nc1, d1l0nc2, d1l0nd1, d1l0nd2, d1l0ne1, d1l0ne2, d1l0nf_, d1l0ng_, d1l0ni_, d1l0nj_, d1l0nk_ |
PDB Entry: 1l0n (more details), 2.6 Å
SCOP Domain Sequences for d1l0nh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1l0nh_ f.28.1.1 (H:) Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Cow (Bos taurus)} eeeelvdplttvreqceqlekcvkarerlelcdervssrsqteedcteelldflhardhc vahklfnslk
Timeline for d1l0nh_: