SCOPe 2.02: Domain d1l0ng_: 1l0n G:

Lineage for d1l0ng_ (1l0n G:)

1. Root: SCOPe 2.02

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.23: Single transmembrane helix [81407] (38 superfamilies)
   not a true fold

4. Superfamily f.23.13: Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81508] (1 family)

5. Family f.23.13.1: Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81507] (2 proteins)

6. Protein Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81506] (3 species)
   together with cytochrome b binds to ubiquinone

7. Species Cow (Bos taurus) [TaxId:9913] [81503] (18 PDB entries)
   Uniprot P13271 #SP ! Uniprot P13271

8. Domain d1l0ng_: 1l0n G: [84509]
   Other proteins in same PDB: d1l0na1, d1l0na2, d1l0nb1, d1l0nb2, d1l0nc1, d1l0nc2, d1l0nd1, d1l0nd2, d1l0ne1, d1l0ne2, d1l0nf_, d1l0nh_, d1l0ni_, d1l0nj_, d1l0nk_
   complexed with fes, hem

Details for d1l0ng_

PDB Entry: 1l0n, 2.6 Å

PDB Description: native structure of bovine mitochondrial cytochrome bc1 complex

PDB Compounds: (G:) ubiquinol-cytochrome c reductase complex ubiquinone-binding protein qp-c

SCOPe Domain Sequences for d1l0ng_:

Sequence; same for both SEQRES and ATOM records:

>d1l0ng_ f.23.13.1 (G:) Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Cow (Bos taurus) [TaxId: 9913]}
grqfghltrvrhvityslspfeqrafphyfskgipnvlrrtracilrvappfvafylvyt
wgtqefekskrknpa

Timeline for d1l0ng_:

• d1l0ng_ first appeared in SCOP 1.65
  
• d1l0ng_ appears in SCOPe 2.01
  
• d1l0ng_ appears in SCOPe 2.03
  
• d1l0ng_ appears in the current release, SCOPe 2.08