Lineage for d1l0ng_ (1l0n G:)

  1. Root: SCOP 1.71
  2. 619386Class f: Membrane and cell surface proteins and peptides [56835] (49 folds)
  3. 620228Fold f.23: Single transmembrane helix [81407] (30 superfamilies)
    not a true fold
  4. 620497Superfamily f.23.13: Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81508] (1 family) (S)
  5. 620498Family f.23.13.1: Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81507] (1 protein)
  6. 620499Protein Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81506] (3 species)
    together with cytochrome b binds to ubiquinone
  7. 620510Species Cow (Bos taurus) [TaxId:9913] [81503] (12 PDB entries)
  8. 620519Domain d1l0ng_: 1l0n G: [84509]
    Other proteins in same PDB: d1l0na1, d1l0na2, d1l0nb1, d1l0nb2, d1l0nc1, d1l0nc2, d1l0nd1, d1l0nd2, d1l0ne1, d1l0ne2, d1l0nf_, d1l0nh_, d1l0ni_, d1l0nj_, d1l0nk_
    complexed with fes, hem

Details for d1l0ng_

PDB Entry: 1l0n (more details), 2.6 Å

PDB Description: native structure of bovine mitochondrial cytochrome bc1 complex
PDB Compounds: (G:)

SCOP Domain Sequences for d1l0ng_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l0ng_ f.23.13.1 (G:) Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Cow (Bos taurus)}
grqfghltrvrhvityslspfeqrafphyfskgipnvlrrtracilrvappfvafylvyt
wgtqefekskrknpa

SCOP Domain Coordinates for d1l0ng_:

Click to download the PDB-style file with coordinates for d1l0ng_.
(The format of our PDB-style files is described here.)

Timeline for d1l0ng_: