Class f: Membrane and cell surface proteins and peptides [56835] (59 folds) |
Fold f.27: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81525] (1 superfamily) membrane-associated alpha-helical protein; no transmembrane helices |
Superfamily f.27.1: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81524] (1 family) location - matrix side of the bc1 complex automatically mapped to Pfam PF02271 |
Family f.27.1.1: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81523] (2 proteins) probably important for the complex assembly, caps the matrix face of cytochrome b |
Protein 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81522] (3 species) |
Species Cow (Bos taurus) [TaxId:9913] [81519] (14 PDB entries) Uniprot P00129 |
Domain d1l0nf_: 1l0n F: [84508] Other proteins in same PDB: d1l0na1, d1l0na2, d1l0nb1, d1l0nb2, d1l0nc1, d1l0nc2, d1l0nd1, d1l0nd2, d1l0ne1, d1l0ne2, d1l0ng_, d1l0nh_, d1l0ni_, d1l0nj_, d1l0nk_ complexed with fes, hem |
PDB Entry: 1l0n (more details), 2.6 Å
SCOPe Domain Sequences for d1l0nf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1l0nf_ f.27.1.1 (F:) 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Cow (Bos taurus) [TaxId: 9913]} vsassrwlegirkwyynaagfnklglmrddtihenddvkeairrlpenlyddrvfrikra ldlsmrqqilpkeqwtkyeedksylepylkevirerkereewakk
Timeline for d1l0nf_: