SCOP 1.75: Domain d1l0nf_: 1l0n F:

Lineage for d1l0nf_ (1l0n F:)

1. Root: SCOP 1.75

2. Class f: Membrane and cell surface proteins and peptides [56835] (58 folds)

3. Fold f.27: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81525] (1 superfamily)
   membrane-associated alpha-helical protein; no transmembrane helices

4. Superfamily f.27.1: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81524] (1 family)
   location - matrix side of the bc1 complex

5. Family f.27.1.1: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81523] (1 protein)
   probably important for the complex assembly, caps the matrix face of cytochrome b

6. Protein 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81522] (3 species)

7. Species Cow (Bos taurus) [TaxId:9913] [81519] (18 PDB entries)
   Uniprot P00129

8. Domain d1l0nf_: 1l0n F: [84508]
   Other proteins in same PDB: d1l0na1, d1l0na2, d1l0nb1, d1l0nb2, d1l0nc1, d1l0nc2, d1l0nd1, d1l0nd2, d1l0ne1, d1l0ne2, d1l0ng_, d1l0nh_, d1l0ni_, d1l0nj_, d1l0nk_
   complexed with fes, hem

Details for d1l0nf_

PDB Entry: 1l0n, 2.6 Å

PDB Description: native structure of bovine mitochondrial cytochrome bc1 complex

PDB Compounds: (F:) Ubiquinol-cytochrome c reductase complex 14 kDa protein

SCOP Domain Sequences for d1l0nf_:

Sequence; same for both SEQRES and ATOM records:

>d1l0nf_ f.27.1.1 (F:) 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Cow (Bos taurus) [TaxId: 9913]}
vsassrwlegirkwyynaagfnklglmrddtihenddvkeairrlpenlyddrvfrikra
ldlsmrqqilpkeqwtkyeedksylepylkevirerkereewakk

Timeline for d1l0nf_:

• d1l0nf_ first appeared in SCOP 1.65
  
• d1l0nf_ appears in SCOP 1.73
  
• d1l0nf_ appears in SCOPe 2.01
  
• d1l0nf_ appears in the current release, SCOPe 2.08