Lineage for d1l0ne2 (1l0n E:1-69)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3024792Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 3025862Superfamily f.23.12: ISP transmembrane anchor [81502] (2 families) (S)
  5. 3025863Family f.23.12.1: ISP transmembrane anchor [81501] (2 proteins)
  6. 3025864Protein Iron-sulfur subunit (ISP) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane region [81500] (4 species)
  7. 3025883Species Cow (Bos taurus) [TaxId:9913] [81497] (19 PDB entries)
    Uniprot P13272; precursor of chains I,E and V,R
  8. 3025895Domain d1l0ne2: 1l0n E:1-69 [84507]
    Other proteins in same PDB: d1l0na1, d1l0na2, d1l0nb1, d1l0nb2, d1l0nc1, d1l0nc2, d1l0nd1, d1l0nd2, d1l0ne1, d1l0nf_, d1l0ng_, d1l0nh_, d1l0ni_, d1l0nj_, d1l0nk_
    complexed with fes, hem

Details for d1l0ne2

PDB Entry: 1l0n (more details), 2.6 Å

PDB Description: native structure of bovine mitochondrial cytochrome bc1 complex
PDB Compounds: (E:) ubiquinol-cytochrome c reductase iron-sulfur subunit

SCOPe Domain Sequences for d1l0ne2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l0ne2 f.23.12.1 (E:1-69) Iron-sulfur subunit (ISP) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane region {Cow (Bos taurus) [TaxId: 9913]}
shtdikvpdfsdyrrpevldstksskessearkgfsylvtatttvgvayaaknvvsqfvs
smsasadvl

SCOPe Domain Coordinates for d1l0ne2:

Click to download the PDB-style file with coordinates for d1l0ne2.
(The format of our PDB-style files is described here.)

Timeline for d1l0ne2: