Lineage for d1l0nb2 (1l0n B:236-439)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 337578Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily)
    core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta
  4. 337579Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (2 families) (S)
    Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues
  5. 337580Family d.185.1.1: MPP-like [63412] (4 proteins)
    Common fold elaborated with many additional structures; duplication: each family member consists of two similar domains of beta(2)-alpha(2)-beta(2)-alpha(5)-beta structure, but only the N-terminal domain of MPP beta chain binds the catalytic metal
  6. 337613Protein Cytochrome bc1 core subunit 2 [63409] (3 species)
  7. 337632Species Cow (Bos taurus) [TaxId:9913] [56000] (5 PDB entries)
  8. 337636Domain d1l0nb2: 1l0n B:236-439 [84501]
    Other proteins in same PDB: d1l0na1, d1l0na2, d1l0nc1, d1l0nc2, d1l0nd1, d1l0nd2, d1l0ne1, d1l0ne2, d1l0nf_, d1l0ng_, d1l0nh_, d1l0ni_, d1l0nj_, d1l0nk_
    complexed with fes, hem

Details for d1l0nb2

PDB Entry: 1l0n (more details), 2.6 Å

PDB Description: native structure of bovine mitochondrial cytochrome bc1 complex
PDB Compounds: (B:)

SCOP Domain Sequences for d1l0nb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l0nb2 d.185.1.1 (B:236-439) Cytochrome bc1 core subunit 2 {Cow (Bos taurus)}
kakyhggeireqngdslvhaalvaesaaigsaeanafsvlqhvlgagphvkrgsnatssl
yqavakgvhqpfdvsafnasysdsglfgfytisqaasagdvikaaynqvktiaqgnlsnp
dvqaaknklkagylmsvessegfldevgsqalaagsytppstvlqqidavadadvinaak
kfvsgrksmaasgnlghtpfidel

SCOP Domain Coordinates for d1l0nb2:

Click to download the PDB-style file with coordinates for d1l0nb2.
(The format of our PDB-style files is described here.)

Timeline for d1l0nb2: