Lineage for d1l0lk_ (1l0l K:)

  1. Root: SCOPe 2.03
  2. 1454900Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1456646Fold f.23: Single transmembrane helix [81407] (38 superfamilies)
    not a true fold
  4. 1457370Superfamily f.23.15: Subunit XI (6.4 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81518] (1 family) (S)
    automatically mapped to Pfam PF08997
  5. 1457371Family f.23.15.1: Subunit XI (6.4 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81517] (2 proteins)
  6. 1457372Protein Subunit XI (6.4 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81516] (1 species)
    the smallest subunit of the complex, interacts with subunit 10 and ISP, peripherally located
  7. 1457373Species Cow (Bos taurus) [TaxId:9913] [81515] (12 PDB entries)
    Uniprot P07552
  8. 1457375Domain d1l0lk_: 1l0l K: [84497]
    Other proteins in same PDB: d1l0la1, d1l0la2, d1l0lb1, d1l0lb2, d1l0lc1, d1l0lc2, d1l0ld1, d1l0ld2, d1l0le1, d1l0le2, d1l0lf_, d1l0lg_, d1l0lh_, d1l0li_, d1l0lj_
    complexed with fes, fmx, hem

Details for d1l0lk_

PDB Entry: 1l0l (more details), 2.35 Å

PDB Description: structure of bovine mitochondrial cytochrome bc1 complex with a bound fungicide famoxadone
PDB Compounds: (K:) Ubiquinol-cytochrome c reductase complex 6.4 kDa protein

SCOPe Domain Sequences for d1l0lk_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l0lk_ f.23.15.1 (K:) Subunit XI (6.4 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Cow (Bos taurus) [TaxId: 9913]}
mltrflgpryrqlarnwvptaqlwgavgavglvwatdwrlildwvpyingkfk

SCOPe Domain Coordinates for d1l0lk_:

Click to download the PDB-style file with coordinates for d1l0lk_.
(The format of our PDB-style files is described here.)

Timeline for d1l0lk_: