SCOP 1.65: Domain d1l0lj_: 1l0l J:

Lineage for d1l0lj_ (1l0l J:)

1. Root: SCOP 1.65

2. Class f: Membrane and cell surface proteins and peptides [56835] (36 folds)

3. Fold f.23: Single transmembrane helix [81407] (22 superfamilies)
   not a true fold

4. Superfamily f.23.14: Subunit X (nonheme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81514] (1 family)

5. Family f.23.14.1: Subunit X (nonheme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81513] (1 protein)

6. Protein Subunit X (nonheme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81512] (3 species)
   inteacts with cytochrome c1 and ISP

7. Species Cow (Bos taurus) [TaxId:9913] [81509] (5 PDB entries)

8. Domain d1l0lj_: 1l0l J: [84496]
   Other proteins in same PDB: d1l0la1, d1l0la2, d1l0lb1, d1l0lb2, d1l0lc1, d1l0lc2, d1l0ld1, d1l0ld2, d1l0le1, d1l0le2, d1l0lf_, d1l0lg_, d1l0lh_, d1l0li_, d1l0lk_
   complexed with fes, fmx, hem

Details for d1l0lj_

PDB Entry: 1l0l, 2.35 Å

PDB Description: structure of bovine mitochondrial cytochrome bc1 complex with a bound fungicide famoxadone

SCOP Domain Sequences for d1l0lj_:

Sequence; same for both SEQRES and ATOM records:

>d1l0lj_ f.23.14.1 (J:) Subunit X (nonheme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Cow (Bos taurus)}
aptltarlysllfrrtstfaltivvgalfferafdqgadaiyehinegklwkhikhkyen

Timeline for d1l0lj_:

• d1l0lj_ is new in SCOP 1.65
  
• d1l0lj_ appears in SCOP 1.67
  
• d1l0lj_ appears in the current release, SCOPe 2.08