SCOP 1.67: Domain d1l0li_: 1l0l I:

Lineage for d1l0li_ (1l0l I:)

1. Root: SCOP 1.67

2. Class d: Alpha and beta proteins (a+b) [53931] (260 folds)

3. Fold d.184: Non-globular alpha+beta subunits of globular proteins [56567] (1 superfamily)
   not a true fold

4. Superfamily d.184.1: Non-globular alpha+beta subunits of globular proteins [56568] (3 families)
   not a true superfamily

5. Family d.184.1.3: Ubiquinol-cytochrome c reductase 8 kDa protein [90077] (1 protein)
   beta-hairpin and a short alpha-helix bound to the core subunits

6. Protein Ubiquinol-cytochrome c reductase 8 kDa protein [90078] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [90079] (6 PDB entries)
   there are other PDB entries with lower resolution structures of the Ubiquinol-cytochrome c reductase complex, in which this subunit has incomplete and probably mistraced structure that is not classified in scop

8. Domain d1l0li_: 1l0l I: [84495]
   Other proteins in same PDB: d1l0la1, d1l0la2, d1l0lb1, d1l0lb2, d1l0lc1, d1l0lc2, d1l0ld1, d1l0ld2, d1l0le1, d1l0le2, d1l0lf_, d1l0lg_, d1l0lh_, d1l0lj_, d1l0lk_
   complexed with fes, fmx, hem

Details for d1l0li_

PDB Entry: 1l0l, 2.35 Å

PDB Description: structure of bovine mitochondrial cytochrome bc1 complex with a bound fungicide famoxadone

SCOP Domain Sequences for d1l0li_:

Sequence; same for both SEQRES and ATOM records:

>d1l0li_ d.184.1.3 (I:) Ubiquinol-cytochrome c reductase 8 kDa protein {Cow (Bos taurus)}
mlsvaarsgpfapvlsatsrgvagalrplvqaavpatsespvldlkrsvlcreslrg

Timeline for d1l0li_:

• d1l0li_ first appeared in SCOP 1.65
  
• d1l0li_ appears in SCOP 1.69
  
• d1l0li_ appears in the current release, SCOPe 2.08