Details for d1l0le2

PDB Entry: 1l0l (more details), 2.35 Å

PDB Description: structure of bovine mitochondrial cytochrome bc1 complex with a bound fungicide famoxadone
PDB Compounds: (E:)

SCOP Domain Sequences for d1l0le2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l0le2 f.23.12.1 (E:1-69) Iron-sulfur subunit (ISP) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane region {Cow (Bos taurus)}
shtdikvpdfsdyrrpevldstksskessearkgfsylvtatttvgvayaaknvvsqfvs
smsasadvl

SCOP Domain Coordinates for d1l0le2:

Click to download the PDB-style file with coordinates for d1l0le2.
(The format of our PDB-style files is described here.)

Timeline for d1l0le2: