SCOPe 2.06: Domain d1l0lc2: 1l0l C:3-260

Lineage for d1l0lc2 (1l0l C:3-260)

1. Root: SCOPe 2.06

2. Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)

3. Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies)
   core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices

4. Superfamily f.21.1: Transmembrane di-heme cytochromes [81342] (2 families)
   Three of the four heme-ligands are conserved between the two families; both heme groups bind similarly but not identically

5. Family f.21.1.2: Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81642] (3 proteins)
   a part (domain) of a larger mitochondrial cytochrome b subunit, separate subunit in plants and cyanobacteria

6. Protein Mitochondrial cytochrome b subunit, N-terminal domain [81641] (3 species)
   also includes extra transmembrane (linker) helix absent in plants and cyanobacteria subunits

7. Species Cow (Bos taurus) [TaxId:9913] [81638] (18 PDB entries)
   Uniprot P00157

8. Domain d1l0lc2: 1l0l C:3-260 [84487]
   Other proteins in same PDB: d1l0la1, d1l0la2, d1l0lb1, d1l0lb2, d1l0lc1, d1l0ld1, d1l0ld2, d1l0le1, d1l0le2, d1l0lf_, d1l0lg_, d1l0lh_, d1l0li_, d1l0lj_, d1l0lk_
   complexed with fes, fmx, hem

Details for d1l0lc2

PDB Entry: 1l0l, 2.35 Å

PDB Description: structure of bovine mitochondrial cytochrome bc1 complex with a bound fungicide famoxadone

PDB Compounds: (C:) cytochrome b

SCOPe Domain Sequences for d1l0lc2:

Sequence; same for both SEQRES and ATOM records:

>d1l0lc2 f.21.1.2 (C:3-260) Mitochondrial cytochrome b subunit, N-terminal domain {Cow (Bos taurus) [TaxId: 9913]}
nirkshplmkivnnafidlpapsnisswwnfgsllgiclilqiltglflamhytsdttta
fssvthicrdvnygwiirymhangasmfficlymhvgrglyygsytfletwnigvilllt
vmatafmgyvlpwgqmsfwgatvitnllsaipyigtnlvewiwggfsvdkatltrffafh
filpfiimaiamvhllflhetgsnnptgissdvdkipfhpyytikdilgalllilalmll
vlfapdllgdpdnytpan

Timeline for d1l0lc2:

• d1l0lc2 first appeared in SCOP 1.65
  
• d1l0lc2 appears in SCOPe 2.05
  
• d1l0lc2 appears in SCOPe 2.07
  
• d1l0lc2 appears in the current release, SCOPe 2.08