Class f: Membrane and cell surface proteins and peptides [56835] (59 folds) |
Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies) core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices |
Superfamily f.21.1: Transmembrane di-heme cytochromes [81342] (2 families) Three of the four heme-ligands are conserved between the two families; both heme groups bind similarly but not identically |
Family f.21.1.2: Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81642] (3 proteins) a part (domain) of a larger mitochondrial cytochrome b subunit, separate subunit in plants and cyanobacteria |
Protein Mitochondrial cytochrome b subunit, N-terminal domain [81641] (3 species) also includes extra transmembrane (linker) helix absent in plants and cyanobacteria subunits |
Species Cow (Bos taurus) [TaxId:9913] [81638] (18 PDB entries) Uniprot P00157 |
Domain d1l0lc2: 1l0l C:3-260 [84487] Other proteins in same PDB: d1l0la1, d1l0la2, d1l0lb1, d1l0lb2, d1l0lc1, d1l0ld1, d1l0ld2, d1l0le1, d1l0le2, d1l0lf_, d1l0lg_, d1l0lh_, d1l0li_, d1l0lj_, d1l0lk_ complexed with fes, fmx, hem |
PDB Entry: 1l0l (more details), 2.35 Å
SCOPe Domain Sequences for d1l0lc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1l0lc2 f.21.1.2 (C:3-260) Mitochondrial cytochrome b subunit, N-terminal domain {Cow (Bos taurus) [TaxId: 9913]} nirkshplmkivnnafidlpapsnisswwnfgsllgiclilqiltglflamhytsdttta fssvthicrdvnygwiirymhangasmfficlymhvgrglyygsytfletwnigvilllt vmatafmgyvlpwgqmsfwgatvitnllsaipyigtnlvewiwggfsvdkatltrffafh filpfiimaiamvhllflhetgsnnptgissdvdkipfhpyytikdilgalllilalmll vlfapdllgdpdnytpan
Timeline for d1l0lc2: