SCOPe 2.05: Domain d1kzwa_: 1kzw A:

Lineage for d1kzwa_ (1kzw A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.2: Fatty acid binding protein-like [50847] (18 proteins)
   ten-stranded meander beta-sheet folded upon itself
   relates to the common fold by opening the barrel and insertion of beta-hairpin

6. Protein Intestinal fatty acid binding protein [50851] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50853] (5 PDB entries)

8. Domain d1kzwa_: 1kzw A: [84478]

Details for d1kzwa_

PDB Entry: 1kzw

PDB Description: solution structure of human intestinal fatty acid binding protein

PDB Compounds: (A:) intestinal fatty acid-binding protein (a54)

SCOPe Domain Sequences for d1kzwa_:

Sequence; same for both SEQRES and ATOM records:

>d1kzwa_ b.60.1.2 (A:) Intestinal fatty acid binding protein {Human (Homo sapiens) [TaxId: 9606]}
afdstwkvdrsenydkfmekmgvnivkrklaahdnlkltitqegnkftvkessafrniev
vfelgvtfnynladgtelrgtwslegnkligkfkrtdngnelntvreiigdelvqtyvye
gveakrifkkd

Timeline for d1kzwa_:

• d1kzwa_ first appeared in SCOP 1.65
  
• d1kzwa_ appears in SCOPe 2.04
  
• d1kzwa_ appears in SCOPe 2.06
  
• d1kzwa_ appears in the current release, SCOPe 2.08