Lineage for d1kxoa_ (1kxo A:)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 300926Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 300927Superfamily b.60.1: Lipocalins [50814] (3 families) (S)
    bind hydrophobic ligands in their interior
  5. 300928Family b.60.1.1: Retinol binding protein-like [50815] (17 proteins)
    barrel, closed; n=8, S=12, meander
  6. 300970Protein Bilin-binding protein [50837] (1 species)
  7. 300971Species Cabbage butterfly (Pieris brassicae) [TaxId:7116] [50838] (4 PDB entries)
  8. 300972Domain d1kxoa_: 1kxo A: [84475]
    engineered variant diga16
    mutant

Details for d1kxoa_

PDB Entry: 1kxo (more details), 1.8 Å

PDB Description: engineered lipocalin diga16 : apo-form

SCOP Domain Sequences for d1kxoa_:

Sequence, based on SEQRES records: (download)

>d1kxoa_ b.60.1.1 (A:) Bilin-binding protein {Cabbage butterfly (Pieris brassicae)}
dvyhdgacpevkpvdnfdwsqyhgkwwqvaaypdhitkygkcgwaeytpegksvkvsrys
vihgkeyfsegtaypvgdskigkiyhsytiggvtqegvfnvlstdnknyiigyfcsyded
kkghmdlvwvlsrsmvltgeaktavenyligspvvdsqklvysdfseaack

Sequence, based on observed residues (ATOM records): (download)

>d1kxoa_ b.60.1.1 (A:) Bilin-binding protein {Cabbage butterfly (Pieris brassicae)}
dvyhdgacpevkpvdnfdwsqyhgkwwqvaaypdhitkygkcgwaeytpegksvkvsrys
vihgkeyfsegtaypvgdskigkiyhsytgvtqegvfnvlstdnknyiigyfcsydkkgh
mdlvwvlsrsmvltgeaktavenyligspvvdsqklvysdfseck

SCOP Domain Coordinates for d1kxoa_:

Click to download the PDB-style file with coordinates for d1kxoa_.
(The format of our PDB-style files is described here.)

Timeline for d1kxoa_: