Lineage for d1kuqa_ (1kuq A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2311085Fold a.16: S15/NS1 RNA-binding domain [47059] (1 superfamily)
    3 helices; irregular array
  4. 2311086Superfamily a.16.1: S15/NS1 RNA-binding domain [47060] (4 families) (S)
  5. 2311142Family a.16.1.2: Ribosomal protein S15 [47064] (1 protein)
    contains additional N-terminal helix that forms a separate unit
    automatically mapped to Pfam PF00312
  6. 2311143Protein Ribosomal protein S15 [47065] (3 species)
  7. 2311157Species Thermus thermophilus [TaxId:274] [47067] (42 PDB entries)
    Uniprot P80378
  8. 2311160Domain d1kuqa_: 1kuq A: [84470]
    complex with an rRNA fragment
    protein/RNA complex; complexed with so4; mutant

Details for d1kuqa_

PDB Entry: 1kuq (more details), 2.84 Å

PDB Description: crystal structure of t3c mutant s15 ribosomal protein in complex with 16s rrna
PDB Compounds: (A:) 30S ribosomal protein S15

SCOPe Domain Sequences for d1kuqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kuqa_ a.16.1.2 (A:) Ribosomal protein S15 {Thermus thermophilus [TaxId: 274]}
ckeekqkviqefarfpgdtgstevqvalltlrinrlsehlkvhkkdhhshrgllmmvgqr
rrllrylqredperyralieklgi

SCOPe Domain Coordinates for d1kuqa_:

Click to download the PDB-style file with coordinates for d1kuqa_.
(The format of our PDB-style files is described here.)

Timeline for d1kuqa_: