Class b: All beta proteins [48724] (126 folds) |
Fold b.60: Lipocalins [50813] (1 superfamily) barrel, closed or opened; n=8, S=12; meander |
Superfamily b.60.1: Lipocalins [50814] (3 families) bind hydrophobic ligands in their interior |
Family b.60.1.1: Retinol binding protein-like [50815] (17 proteins) barrel, closed; n=8, S=12, meander |
Protein Retinol binding protein [50816] (5 species) |
Species Cow (Bos taurus) [TaxId:9913] [50817] (13 PDB entries) |
Domain d1kt3a_: 1kt3 A: [84463] complexed with rtl |
PDB Entry: 1kt3 (more details), 1.4 Å
SCOP Domain Sequences for d1kt3a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kt3a_ b.60.1.1 (A:) Retinol binding protein {Cow (Bos taurus)} erdcrvssfrvkenfdkarfagtwyamakkdpeglflqdnivaefsvdenghmsatakgr vrllnnwdvcadmvgtftdtedpakfkmkywgvasflqkgnddhwiidtdyetfavqysc rllnldgtcadsysfvfardpsgfspevqkivrqrqeelclarqyrliphngycd
Timeline for d1kt3a_: