Lineage for d1kt3a_ (1kt3 A:)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 300926Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 300927Superfamily b.60.1: Lipocalins [50814] (3 families) (S)
    bind hydrophobic ligands in their interior
  5. 300928Family b.60.1.1: Retinol binding protein-like [50815] (17 proteins)
    barrel, closed; n=8, S=12, meander
  6. 301081Protein Retinol binding protein [50816] (5 species)
  7. 301087Species Cow (Bos taurus) [TaxId:9913] [50817] (13 PDB entries)
  8. 301090Domain d1kt3a_: 1kt3 A: [84463]
    complexed with rtl

Details for d1kt3a_

PDB Entry: 1kt3 (more details), 1.4 Å

PDB Description: Crystal structure of bovine holo-RBP at pH 2.0

SCOP Domain Sequences for d1kt3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kt3a_ b.60.1.1 (A:) Retinol binding protein {Cow (Bos taurus)}
erdcrvssfrvkenfdkarfagtwyamakkdpeglflqdnivaefsvdenghmsatakgr
vrllnnwdvcadmvgtftdtedpakfkmkywgvasflqkgnddhwiidtdyetfavqysc
rllnldgtcadsysfvfardpsgfspevqkivrqrqeelclarqyrliphngycd

SCOP Domain Coordinates for d1kt3a_:

Click to download the PDB-style file with coordinates for d1kt3a_.
(The format of our PDB-style files is described here.)

Timeline for d1kt3a_: