Lineage for d1kpva1 (1kpv A:182-274)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 781543Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 783929Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 784408Protein Class I MHC, alpha-3 domain [88604] (4 species)
  7. 784629Species Mouse (Mus musculus) [TaxId:10090] [88606] (89 PDB entries)
    Uniprot P01901 22-299
  8. 784635Domain d1kpva1: 1kpv A:182-274 [84459]
    Other proteins in same PDB: d1kpva2, d1kpvb_
    complexed with fuc, mpd, nag, po4

Details for d1kpva1

PDB Entry: 1kpv (more details), 1.71 Å

PDB Description: high resolution crystal structure of the mhc class i complex h- 2kb/sev9
PDB Compounds: (A:) h-2 class I histocompatibility antigen, k-b alpha chain

SCOP Domain Sequences for d1kpva1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kpva1 b.1.1.2 (A:182-274) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]}
tdspkahvthhsrpedkvtlrcwalgfypaditltwqlngeeliqdmelvetrpagdgtf
qkwasvvvplgkeqyytchvyhqglpepltlrw

SCOP Domain Coordinates for d1kpva1:

Click to download the PDB-style file with coordinates for d1kpva1.
(The format of our PDB-style files is described here.)

Timeline for d1kpva1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1kpva2
View in 3D
Domains from other chains:
(mouse over for more information)
d1kpvb_