Lineage for d1kpub_ (1kpu B:)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 287096Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 288543Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)
  6. 288544Protein beta2-microglobulin [88600] (4 species)
  7. 288646Species Mouse (Mus musculus) [TaxId:10090] [88603] (48 PDB entries)
  8. 288647Domain d1kpub_: 1kpu B: [84458]
    Other proteins in same PDB: d1kpua1, d1kpua2
    complexed with fuc, mpd, nag

Details for d1kpub_

PDB Entry: 1kpu (more details), 1.5 Å

PDB Description: high resolution crystal structure of the mhc class i complex h- 2kb/vsv8

SCOP Domain Sequences for d1kpub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kpub_ b.1.1.2 (B:) beta2-microglobulin {Mouse (Mus musculus)}
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm

SCOP Domain Coordinates for d1kpub_:

Click to download the PDB-style file with coordinates for d1kpub_.
(The format of our PDB-style files is described here.)

Timeline for d1kpub_: