Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) |
Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins) |
Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (27 species) |
Species Mouse (Mus musculus), H-2KB [TaxId:10090] [54481] (40 PDB entries) Uniprot P01901 22-299 |
Domain d1kpua2: 1kpu A:1-181 [84457] Other proteins in same PDB: d1kpua1, d1kpub_ complexed with fuc, mpd, nag |
PDB Entry: 1kpu (more details), 1.5 Å
SCOP Domain Sequences for d1kpua2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kpua2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2KB [TaxId: 10090]} gphslryfvtavsrpglgeprymevgyvddtefvrfdsdaenpryeprarwmeqegpeyw eretqkakgneqsfrvdlrtllgyynqskggshtiqvisgcevgsdgrllrgyqqyaydg cdyialnedlktwtaadmaalitkhkweqageaerlraylegtcvewlrrylkngnatll r
Timeline for d1kpua2: