Lineage for d1kpua2 (1kpu A:1-181)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2937550Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2937551Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2937552Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2937656Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species)
  7. 2938107Species Mouse (Mus musculus), H-2KB [TaxId:10090] [54481] (52 PDB entries)
    Uniprot P01901 22-299
  8. 2938109Domain d1kpua2: 1kpu A:1-181 [84457]
    Other proteins in same PDB: d1kpua1, d1kpub_
    complexed with mpd, nag

Details for d1kpua2

PDB Entry: 1kpu (more details), 1.5 Å

PDB Description: high resolution crystal structure of the mhc class i complex h- 2kb/vsv8
PDB Compounds: (A:) h-2 class I histocompatibility antigen, k-b alpha chain

SCOPe Domain Sequences for d1kpua2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kpua2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2KB [TaxId: 10090]}
gphslryfvtavsrpglgeprymevgyvddtefvrfdsdaenpryeprarwmeqegpeyw
eretqkakgneqsfrvdlrtllgyynqskggshtiqvisgcevgsdgrllrgyqqyaydg
cdyialnedlktwtaadmaalitkhkweqageaerlraylegtcvewlrrylkngnatll
r

SCOPe Domain Coordinates for d1kpua2:

Click to download the PDB-style file with coordinates for d1kpua2.
(The format of our PDB-style files is described here.)

Timeline for d1kpua2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1kpua1
View in 3D
Domains from other chains:
(mouse over for more information)
d1kpub_