Lineage for d1kp8m1 (1kp8 M:2-136,M:410-526)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1098640Fold a.129: GroEL equatorial domain-like [48591] (1 superfamily)
    multihelical; 8 helices arranged in 2 parallel layers
  4. 1098641Superfamily a.129.1: GroEL equatorial domain-like [48592] (2 families) (S)
    duplication: two 4-helical subdomains are related by a pseudo dyad passing through the ATP-binding site
  5. 1098642Family a.129.1.1: GroEL chaperone, ATPase domain [48593] (1 protein)
  6. 1098643Protein GroEL, E domain [48594] (4 species)
  7. 1098644Species Escherichia coli [TaxId:562] [48595] (9 PDB entries)
  8. 1098657Domain d1kp8m1: 1kp8 M:2-136,M:410-526 [84450]
    Other proteins in same PDB: d1kp8a2, d1kp8a3, d1kp8b2, d1kp8b3, d1kp8c2, d1kp8c3, d1kp8d2, d1kp8d3, d1kp8e2, d1kp8e3, d1kp8f2, d1kp8f3, d1kp8g2, d1kp8g3, d1kp8h2, d1kp8h3, d1kp8i2, d1kp8i3, d1kp8j2, d1kp8j3, d1kp8k2, d1kp8k3, d1kp8l2, d1kp8l3, d1kp8m2, d1kp8m3, d1kp8n2, d1kp8n3
    complexed with atp, k, mg, so4

Details for d1kp8m1

PDB Entry: 1kp8 (more details), 2 Å

PDB Description: structural basis for groel-assisted protein folding from the crystal structure of (groel-kmgatp)14 at 2.0 a resolution
PDB Compounds: (M:) groEL protein

SCOPe Domain Sequences for d1kp8m1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kp8m1 a.129.1.1 (M:2-136,M:410-526) GroEL, E domain {Escherichia coli [TaxId: 562]}
aakdvkfgndagvkmlrgvnvladavkvtlgpkgrnvvldksfgaptitkdgvsvareie
ledkfenmgaqmvkevaskandaagdgtttatvlaqaiiteglkavaagmnpmdlkrgid
kavtvaveelkalsvXgvvagggvalirvaskladlrgqnadqnvgikvalrameaplrq
ivlncgeepsvvantvkggdgnygynaateeygnmidmgildptkvtrsalqyaasvagl
mittecmvtdlpk

SCOPe Domain Coordinates for d1kp8m1:

Click to download the PDB-style file with coordinates for d1kp8m1.
(The format of our PDB-style files is described here.)

Timeline for d1kp8m1: