Lineage for d1kp8k2 (1kp8 K:191-366)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 310107Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (7 superfamilies)
    3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology
    this domain is thought to be mobile in all proteins known to contain it
  4. 310214Superfamily c.8.5: GroEL apical domain-like [52029] (2 families) (S)
  5. 310215Family c.8.5.1: GroEL-like chaperone, apical domain [52030] (1 protein)
  6. 310216Protein GroEL, A domain [52031] (3 species)
  7. 310217Species Escherichia coli [TaxId:562] [52032] (11 PDB entries)
  8. 310236Domain d1kp8k2: 1kp8 K:191-366 [84445]
    Other proteins in same PDB: d1kp8a1, d1kp8a3, d1kp8b1, d1kp8b3, d1kp8c1, d1kp8c3, d1kp8d1, d1kp8d3, d1kp8e1, d1kp8e3, d1kp8f1, d1kp8f3, d1kp8g1, d1kp8g3, d1kp8h1, d1kp8h3, d1kp8i1, d1kp8i3, d1kp8j1, d1kp8j3, d1kp8k1, d1kp8k3, d1kp8l1, d1kp8l3, d1kp8m1, d1kp8m3, d1kp8n1, d1kp8n3

Details for d1kp8k2

PDB Entry: 1kp8 (more details), 2 Å

PDB Description: structural basis for groel-assisted protein folding from the crystal structure of (groel-kmgatp)14 at 2.0 a resolution

SCOP Domain Sequences for d1kp8k2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kp8k2 c.8.5.1 (K:191-366) GroEL, A domain {Escherichia coli}
egmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleavakagkpllii
aedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtviseeigmele
katledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdydreklq

SCOP Domain Coordinates for d1kp8k2:

Click to download the PDB-style file with coordinates for d1kp8k2.
(The format of our PDB-style files is described here.)

Timeline for d1kp8k2: