Lineage for d1kiac_ (1kia C:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 490261Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 490262Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (39 families) (S)
  5. 490288Family c.66.1.5: Glycine N-methyltransferase [53348] (1 protein)
  6. 490289Protein Glycine N-methyltransferase [53349] (3 species)
  7. 490304Species Rat (Rattus norvegicus) [TaxId:10116] [53350] (8 PDB entries)
  8. 490319Domain d1kiac_: 1kia C: [84409]

Details for d1kiac_

PDB Entry: 1kia (more details), 2.8 Å

PDB Description: crystal structure of glycine n-methyltransferase complexed with s- adenosylmethionine and acetate

SCOP Domain Sequences for d1kiac_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kiac_ c.66.1.5 (C:) Glycine N-methyltransferase {Rat (Rattus norvegicus)}
pdqyadgeaarvwqlyigdtrsrtaeykawllgllrqhgchrvldvacgtgvdsimlvee
gfsvtsvdasdkmlkyalkerwnrrkepafdkwvieeanwltldkdvpagdgfdaviclg
nsfahlpdskgdqsehrlalkniasmvrpggllvidhrnydyilstgcappgkniyyksd
ltkdittsvltvnnkahmvtldytvqvpgagrdgapgfskfrlsyyphclasftelvqea
fggrcqhsvlgdfkpyrpgqayvpcyfihvlkktg

SCOP Domain Coordinates for d1kiac_:

Click to download the PDB-style file with coordinates for d1kiac_.
(The format of our PDB-style files is described here.)

Timeline for d1kiac_: