Lineage for d1ki9c_ (1ki9 C:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2473887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2473888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2473889Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins)
    parallel beta-sheet of 5 strands, order 23145
  6. 2473894Protein Adenylate kinase [52554] (16 species)
  7. 2473941Species Methanococcus thermolithotrophicus [TaxId:2186] [89661] (2 PDB entries)
  8. 2473947Domain d1ki9c_: 1ki9 C: [84406]

Details for d1ki9c_

PDB Entry: 1ki9 (more details), 2.76 Å

PDB Description: Adenylate kinase from Methanococcus thermolithotrophicus
PDB Compounds: (C:) adenylate kinase

SCOPe Domain Sequences for d1ki9c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ki9c_ c.37.1.1 (C:) Adenylate kinase {Methanococcus thermolithotrophicus [TaxId: 2186]}
mknklvvvtgvpgvggttitqkameklseeginykmvnfgtvmfevaqeenlvedrdqmr
kldpdtqkriqklagrkiaemvkespvvvdthstiktpkgylpglpvwvlnelnpdiiiv
vetsgdeilirrlndetrnrdlettagieehqimnraaamtygvltgatvkiiqnknnll
dyaveelisvlr

SCOPe Domain Coordinates for d1ki9c_:

Click to download the PDB-style file with coordinates for d1ki9c_.
(The format of our PDB-style files is described here.)

Timeline for d1ki9c_: