SCOPe 2.06: Domain d1ki9b_: 1ki9 B:

Lineage for d1ki9b_ (1ki9 B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins)
   parallel beta-sheet of 5 strands, order 23145

6. Protein Adenylate kinase [52554] (16 species)

7. Species Methanococcus thermolithotrophicus [TaxId:2186] [89661] (1 PDB entry)

8. Domain d1ki9b_: 1ki9 B: [84405]

Details for d1ki9b_

PDB Entry: 1ki9, 2.76 Å

PDB Description: Adenylate kinase from Methanococcus thermolithotrophicus

PDB Compounds: (B:) adenylate kinase

SCOPe Domain Sequences for d1ki9b_:

Sequence; same for both SEQRES and ATOM records:

>d1ki9b_ c.37.1.1 (B:) Adenylate kinase {Methanococcus thermolithotrophicus [TaxId: 2186]}
mknklvvvtgvpgvggttitqkameklseeginykmvnfgtvmfevaqeenlvedrdqmr
kldpdtqkriqklagrkiaemvkespvvvdthstiktpkgylpglpvwvlnelnpdiiiv
vetsgdeilirrlndetrnrdlettagieehqimnraaamtygvltgatvkiiqnknnll
dyaveelisvlr

Timeline for d1ki9b_:

• d1ki9b_ first appeared in SCOP 1.65
  
• d1ki9b_ appears in SCOPe 2.05
  
• d1ki9b_ appears in SCOPe 2.07
  
• d1ki9b_ appears in the current release, SCOPe 2.08