Lineage for d1kh8a_ (1kh8 A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2174483Fold d.5: RNase A-like [54075] (1 superfamily)
    contains long curved beta-sheet and 3 helices
  4. 2174484Superfamily d.5.1: RNase A-like [54076] (2 families) (S)
    can be classified as disulfide-rich
  5. 2174485Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins)
  6. 2174613Protein Ribonuclease A (also ribonuclease B, S) [54078] (3 species)
  7. 2174614Species Cow (Bos taurus) [TaxId:9913] [54079] (188 PDB entries)
  8. 2174752Domain d1kh8a_: 1kh8 A: [84400]
    complexed with cs, so4

Details for d1kh8a_

PDB Entry: 1kh8 (more details), 2 Å

PDB Description: structure of a cis-proline (p114) to glycine variant of ribonuclease a
PDB Compounds: (A:) Pancreatic Ribonuclease A

SCOPe Domain Sequences for d1kh8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kh8a_ d.5.1.1 (A:) Ribonuclease A (also ribonuclease B, S) {Cow (Bos taurus) [TaxId: 9913]}
mketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcs
qknvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegngyvpvh
fdasv

SCOPe Domain Coordinates for d1kh8a_:

Click to download the PDB-style file with coordinates for d1kh8a_.
(The format of our PDB-style files is described here.)

Timeline for d1kh8a_: